Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) form timeric structures with the orthogonally packed beta-sheets |
Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins) |
Protein PII (product of glnB) [54915] (8 species) trimer with orthogonal packing of beta-sheets around the threefold axis |
Species Escherichia coli [TaxId:562] [54916] (2 PDB entries) |
Domain d1pila_: 1pil A: [39072] |
PDB Entry: 1pil (more details), 2.7 Å
SCOPe Domain Sequences for d1pila_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pila_ d.58.5.1 (A:) PII (product of glnB) {Escherichia coli [TaxId: 562]} mkkidaiikpfklddvrealaevgitgmtvtevkgfgrqkghtelyrgaeymvdflpkvk ieivvpddivdtcvdtiirtaqtgkigdgkifvfdvarvirirtgeeddaai
Timeline for d1pila_: