Lineage for d1pila_ (1pil A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2950563Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2950564Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)
  6. 2950570Protein PII (product of glnB) [54915] (8 species)
    trimer with orthogonal packing of beta-sheets around the threefold axis
  7. 2950597Species Escherichia coli [TaxId:562] [54916] (2 PDB entries)
  8. 2950599Domain d1pila_: 1pil A: [39072]

Details for d1pila_

PDB Entry: 1pil (more details), 2.7 Å

PDB Description: structure of the escherichia coli signal transducing protein pii
PDB Compounds: (A:) signal transducing protein p2

SCOPe Domain Sequences for d1pila_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pila_ d.58.5.1 (A:) PII (product of glnB) {Escherichia coli [TaxId: 562]}
mkkidaiikpfklddvrealaevgitgmtvtevkgfgrqkghtelyrgaeymvdflpkvk
ieivvpddivdtcvdtiirtaqtgkigdgkifvfdvarvirirtgeeddaai

SCOPe Domain Coordinates for d1pila_:

Click to download the PDB-style file with coordinates for d1pila_.
(The format of our PDB-style files is described here.)

Timeline for d1pila_: