Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) |
Family d.73.1.0: automated matches [336551] (1 protein) not a true family |
Protein automated matches [336552] (9 species) not a true protein |
Species Sorghum (Sorghum bicolor) [TaxId:4558] [390646] (1 PDB entry) |
Domain d6kyjs_: 6kyj S: [390701] Other proteins in same PDB: d6kyja1, d6kyja2, d6kyjc1, d6kyjc2, d6kyje1, d6kyje2, d6kyjg1, d6kyjg2 automated match to d1uw9c_ complexed with gol, so4 |
PDB Entry: 6kyj (more details), 1.7 Å
SCOPe Domain Sequences for d6kyjs_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6kyjs_ d.73.1.0 (S:) automated matches {Sorghum (Sorghum bicolor) [TaxId: 4558]} mqvwpaygnkkfetlsylpplteeqllkqvdyllrnnwvpclefskegfvyrenstspcy ydgrywtmwklpmfgctdasqvykelqeaiasypdayvrilgfdnikqtqcvsfiaykp
Timeline for d6kyjs_: