SCOPe 2.08: Domain d6kzhb1: 6kzh B:2-230

Lineage for d6kzhb1 (6kzh B:2-230)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.7: 14-3-3 protein [48445] (1 family)
   automatically mapped to Pfam PF00244

5. Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)

6. Protein automated matches [190238] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187008] (56 PDB entries)

8. Domain d6kzhb1: 6kzh B:2-230 [390686]
   Other proteins in same PDB: d6kzha2, d6kzhb2
   automated match to d4dnkb_
   complexed with sep

Details for d6kzhb1

PDB Entry: 6kzh, 2.65 Å

PDB Description: 14-3-3 protein in complex with cic s173 phosphorylated peptide

PDB Compounds: (B:) 14-3-3 protein theta

SCOPe Domain Sequences for d6kzhb1:

Sequence; same for both SEQRES and ATOM records:

>d6kzhb1 a.118.7.1 (B:2-230) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ekteliqkaklaeqaeryddmatcmkavteqgaelsneernllsvayknvvggrrsawrv
issieqktdtsdkklqlikdyrekveselrsicttvlelldkylianatnpeskvfylkm
kgdyfrylaevacgddrkqtidnsqgayqeafdiskkemqpthpirlglalnfsvfyyei
lnnpelactlaktafdeaiaeldtlnedsykdstlimqllrdnltlwts

Timeline for d6kzhb1:

• d6kzhb1 first appeared in SCOPe 2.07