Lineage for d6ksgb_ (6ksg B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2974562Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 2974563Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) (S)
  5. 2974564Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)
  6. 2974703Protein automated matches [195197] (6 species)
    not a true protein
  7. 2974729Species Vibrio cholerae [TaxId:243277] [390552] (2 PDB entries)
  8. 2974733Domain d6ksgb_: 6ksg B: [390558]
    automated match to d4fo7b_
    complexed with gol, na, ni

Details for d6ksgb_

PDB Entry: 6ksg (more details), 1.9 Å

PDB Description: vibrio cholerae methionine aminopeptidase in holo form
PDB Compounds: (B:) Methionine aminopeptidase

SCOPe Domain Sequences for d6ksgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ksgb_ d.127.1.1 (B:) automated matches {Vibrio cholerae [TaxId: 243277]}
sikiknaveiekmrvagrlaaevlemiephvkagvtteeldqichkyitevqgaipapln
yhgfpksictsinhivchgipasedtyfgqiqrpavlrdgdilniditvikdgyhgdtsk
mfligdvsiedkrlchvaqeclylalkqvkpgvqlgeigttiekhiktnnknnprfkfsi
vrdycghgigaefheepqvvhyknsdrtvlregmiftiepminagkfgcrlddedswtvy
tadgkksaqwehtilvtatgceiltlrseeslprilnna

SCOPe Domain Coordinates for d6ksgb_:

Click to download the PDB-style file with coordinates for d6ksgb_.
(The format of our PDB-style files is described here.)

Timeline for d6ksgb_: