SCOPe 2.08: Domain d6kppc2: 6kpp C:246-441

Lineage for d6kppc2 (6kpp C:246-441)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
Protein automated matches [227071] (7 species)
not a true protein
Species Pig (Sus scrofa) [TaxId:9823] [278816] (66 PDB entries)

Domain d6kppc2: 6kpp C:246-441 [390547]
Other proteins in same PDB: d6kppa1, d6kppb1, d6kppc1, d6kppd1, d6kppe_, d6kppf1, d6kppf2
automated match to d4i50a2
complexed with ca, do6, gdp, gol, gtp, mes, mg

Details for d6kppc2

PDB Entry: 6kpp (more details), 2.75 Å

PDB Description: bnc105 in complex with tubulin

PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d6kppc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6kppc2 d.79.2.1 (C:246-441) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsve

SCOPe Domain Coordinates for d6kppc2:

Click to download the PDB-style file with coordinates for d6kppc2.
(The format of our PDB-style files is described here.)

Timeline for d6kppc2: