SCOPe 2.07: Domain d6kagc_: 6kag C:

Lineage for d6kagc_ (6kag C:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.0: automated matches [191447] (1 protein)
   not a true family

6. Protein automated matches [190674] (25 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189258] (28 PDB entries)

8. Domain d6kagc_: 6kag C: [390480]
   automated match to d5gjka_

Details for d6kagc_

PDB Entry: 6kag, 2.6 Å

PDB Description: crystal structure of the smarcb1/smarcc2 subcomplex

PDB Compounds: (C:) SWI/SNF complex subunit SMARCC2

SCOPe Domain Sequences for d6kagc_:

Sequence; same for both SEQRES and ATOM records:

>d6kagc_ a.4.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hhiiipsyaawfdynsvhaierralpeffngknksktpeiylayrnfmidtyrlnpqeyl
tstacrrnlagdvcaimrvhafleqwglinyqv

Timeline for d6kagc_:

• d6kagc_ is new in SCOPe 2.07-stable
  
• d6kagc_ appears in the current release, SCOPe 2.08