SCOPe 2.08: Domain d7k86b2: 7k86 B:299-464

Lineage for d7k86b2 (7k86 B:299-464)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.97: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48162] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.97.1: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48163] (3 families)

5. Family a.97.1.0: automated matches [227179] (1 protein)
   not a true family

6. Protein automated matches [226898] (7 species)
   not a true protein

7. Species Stenotrophomonas maltophilia [TaxId:522373] [390453] (1 PDB entry)

8. Domain d7k86b2: 7k86 B:299-464 [390454]
   Other proteins in same PDB: d7k86a1, d7k86b1
   automated match to d5h4va2
   complexed with act, edo

Details for d7k86b2

PDB Entry: 7k86, 2.05 Å

PDB Description: crystal structure of glutamyl-trna synthetase (gltx) from stenotrophomonas maltophilia

PDB Compounds: (B:) Glutamate--tRNA ligase

SCOPe Domain Sequences for d7k86b2:

Sequence; same for both SEQRES and ATOM records:

>d7k86b2 a.97.1.0 (B:299-464) automated matches {Stenotrophomonas maltophilia [TaxId: 522373]}
dmaklgwvnqhflktedvaaivphlvyqlqklgldvaagpapedvvvalrervqtlkema
ekavvwyqplteydeaavakhfkagaevalgkarellaalpewtaesvgvalhdaaaale
igmgkvaqplrvaitgtqvspdishtvylagreqalkridvaitkv

Timeline for d7k86b2:

• d7k86b2 first appeared in SCOPe 2.07