Lineage for d7k9pa1 (7k9p A:2-191)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894145Family c.66.1.48: Nsp15 N-terminal domain-like [142625] (2 proteins)
    rudiment methyltransferase fold that probably has lost the enzymatic activity; contains extra N-terminal alpha+beta subdomain
  6. 2894162Protein automated matches [381979] (1 species)
    not a true protein
  7. 2894163Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [382217] (36 PDB entries)
  8. 2894235Domain d7k9pa1: 7k9p A:2-191 [390432]
    Other proteins in same PDB: d7k9pa2, d7k9pa3, d7k9pb2, d7k9pb3
    automated match to d2rhba1
    complexed with cit

Details for d7k9pa1

PDB Entry: 7k9p (more details), 2.6 Å

PDB Description: room temperature structure of nsp15 endoribonuclease from sars cov-2 solved using sfx.
PDB Compounds: (A:) Uridylate-specific endoribonuclease

SCOPe Domain Sequences for d7k9pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7k9pa1 c.66.1.48 (A:2-191) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
slenvafnvvnkghfdgqqgevpvsiinntvytkvdgvdvelfenkttlpvnvafelwak
rnikpvpevkilnnlgvdiaantviwdykrdapahistigvcsmtdiakkpteticaplt
vffdgrvdgqvdlfrnarngvlitegsvkglqpsvgpkqaslngvtligeavktqfnyyk
kvdgvvqqlp

SCOPe Domain Coordinates for d7k9pa1:

Click to download the PDB-style file with coordinates for d7k9pa1.
(The format of our PDB-style files is described here.)

Timeline for d7k9pa1: