SCOPe 2.08: Domain d7jx3l2: 7jx3 L:108-215

Lineage for d7jx3l2 (7jx3 L:108-215)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d7jx3l2: 7jx3 L:108-215 [390352]
   Other proteins in same PDB: d7jx3b1, d7jx3c_, d7jx3d1, d7jx3h_, d7jx3l1, d7jx3r_
   automated match to d1dn0a2
   complexed with nag

Details for d7jx3l2

PDB Entry: 7jx3, 2.65 Å

PDB Description: mapping neutralizing and immunodominant sites on the sars-cov-2 spike receptor-binding domain by structure-guided high-resolution serology

PDB Compounds: (L:) Light chain of Fab domain of monoclonal antibody S304

SCOPe Domain Sequences for d7jx3l2:

Sequence; same for both SEQRES and ATOM records:

>d7jx3l2 b.1.1.2 (L:108-215) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

Timeline for d7jx3l2:

• d7jx3l2 first appeared in SCOPe 2.07