Lineage for d1raib1 (1rai B:1-100)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2556379Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families) (S)
    automatically mapped to Pfam PF01948
  5. 2556380Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. 2556381Protein Aspartate carbamoyltransferase [54895] (3 species)
  7. 2556382Species Escherichia coli [TaxId:562] [54896] (63 PDB entries)
    Uniprot P00478
  8. 2556468Domain d1raib1: 1rai B:1-100 [39029]
    Other proteins in same PDB: d1raia1, d1raia2, d1raib2, d1raic1, d1raic2, d1raid2
    complexed with ctp, zn; mutant

Details for d1raib1

PDB Entry: 1rai (more details), 2.5 Å

PDB Description: crystal structure of ctp-ligated t state aspartate transcarbamoylase at 2.5 angstroms resolution: implications for atcase mutants and the mechanism of negative cooperativity
PDB Compounds: (B:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d1raib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1raib1 d.58.2.1 (B:1-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]}
mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
ientflsedqvdqlalyapqatvnridnyevvgksrpslp

SCOPe Domain Coordinates for d1raib1:

Click to download the PDB-style file with coordinates for d1raib1.
(The format of our PDB-style files is described here.)

Timeline for d1raib1: