Lineage for d7jmpl1 (7jmp L:3-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2742276Domain d7jmpl1: 7jmp L:3-107 [390265]
    Other proteins in same PDB: d7jmpa_, d7jmpl2
    automated match to d2mcg11
    complexed with nag

Details for d7jmpl1

PDB Entry: 7jmp (more details), 1.71 Å

PDB Description: crystal structure of sars-cov-2 receptor binding domain in complex with neutralizing antibody cova2-39
PDB Compounds: (L:) COVA2-39 light chain

SCOPe Domain Sequences for d7jmpl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7jmpl1 b.1.1.1 (L:3-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
altqpasvsgspgqsitisctgtssdvgsynlvswyqqhpgkapklmiyevtkrpsgvsn
rfsgsksgntasltisglqaedeadyyccsyagsstwvfgggtkltvlg

SCOPe Domain Coordinates for d7jmpl1:

Click to download the PDB-style file with coordinates for d7jmpl1.
(The format of our PDB-style files is described here.)

Timeline for d7jmpl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d7jmpl2