Lineage for d6at1d1 (6at1 D:8-100)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families) 
automatically mapped to Pfam PF01948Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein) Protein Aspartate carbamoyltransferase [54895] (3 species) Species Escherichia coli [TaxId:562] [54896] (63 PDB entries)
Uniprot P00478
Domain d6at1d1: 6at1 D:8-100 [39024]
Other proteins in same PDB: d6at1a1, d6at1a2, d6at1b2, d6at1c1, d6at1c2, d6at1d2
complexed with zn
Details for d6at1d1
PDB Entry: 6at1 (more details), 2.6 Å
PDB Description: structural consequences of effector binding to the t state of aspartate carbamoyltransferase. crystal structures of the unligated and atp-, and ctp-complexed enzymes at 2.6-angstroms resolution
PDB Compounds: (D:) Aspartate carbamoyltransferase regulatory chainSCOPe Domain Sequences for d6at1d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6at1d1 d.58.2.1 (D:8-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]}
gveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientfls
edqvdqlalyapqatvnridnyevvgksrpslp
SCOPe Domain Coordinates for d6at1d1:
Click to download the PDB-style file with coordinates for d6at1d1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6at1d1:
View in 3D
