Lineage for d1h7wc5 (1h7w C:845-1017)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1906288Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 1906422Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 1906437Protein Dihydropyrimidine dehydrogenase, C-terminal domain [54891] (1 species)
    includes linker from domain 4
  7. 1906438Species Pig (Sus scrofa) [TaxId:9823] [54892] (5 PDB entries)
  8. 1906445Domain d1h7wc5: 1h7w C:845-1017 [39009]
    Other proteins in same PDB: d1h7wa1, d1h7wa2, d1h7wa3, d1h7wa4, d1h7wb1, d1h7wb2, d1h7wb3, d1h7wb4, d1h7wc1, d1h7wc2, d1h7wc3, d1h7wc4, d1h7wd1, d1h7wd2, d1h7wd3, d1h7wd4
    complexed with fad, fmn, sf4

Details for d1h7wc5

PDB Entry: 1h7w (more details), 1.9 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) from pig
PDB Compounds: (C:) dihydropyrimidine dehydrogenase

SCOPe Domain Sequences for d1h7wc5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h7wc5 d.58.1.5 (C:845-1017) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
elqgwdgqspgteshqkgkpvpriaelmgkklpnfgpyleqrkkiiaeekmrlkeqnaaf
pplerkpfipkkpipaikdvigkalqylgtfgelsnieqvvavideemcincgkcymtcn
dsgyqaiqfdpethlptvtdtctgctlclsvcpiidcirmvsrttpyepkrgl

SCOPe Domain Coordinates for d1h7wc5:

Click to download the PDB-style file with coordinates for d1h7wc5.
(The format of our PDB-style files is described here.)

Timeline for d1h7wc5: