Lineage for d2pdab5 (2pda B:669-785)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 80004Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 80005Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) (S)
  5. 80087Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (4 proteins)
  6. 80107Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain V [54889] (1 species)
  7. 80108Species Desulfovibrio africanus [TaxId:873] [54890] (2 PDB entries)
  8. 80112Domain d2pdab5: 2pda B:669-785 [39006]
    Other proteins in same PDB: d2pdaa1, d2pdaa2, d2pdaa3, d2pdaa4, d2pdab1, d2pdab2, d2pdab3, d2pdab4

Details for d2pdab5

PDB Entry: 2pda (more details), 3 Å

PDB Description: crystal structure of the complex between pyruvate-ferredoxin oxidoreductase from desulfovibrio africanus and pyruvate.

SCOP Domain Sequences for d2pdab5:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pdab5 d.58.1.5 (B:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus}
tsqfekrgvainvpqwvpenciqcnqcafvcphsailpvlakeeelvgapanftaleakg
kelkgykfriqintldcmgcgncadicppkekalvmqpldtqrdaqvpnleyaarip

SCOP Domain Coordinates for d2pdab5:

Click to download the PDB-style file with coordinates for d2pdab5.
(The format of our PDB-style files is described here.)

Timeline for d2pdab5: