Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
Fold d.58: Ferredoxin-like [54861] (39 superfamilies) |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) |
Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (5 proteins) |
Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain V [54889] (1 species) |
Species Desulfovibrio africanus [TaxId:873] [54890] (3 PDB entries) |
Domain d2pdaa5: 2pda A:669-785 [39005] Other proteins in same PDB: d2pdaa1, d2pdaa2, d2pdaa3, d2pdaa4, d2pdab1, d2pdab2, d2pdab3, d2pdab4 |
PDB Entry: 2pda (more details), 3 Å
SCOP Domain Sequences for d2pdaa5:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pdaa5 d.58.1.5 (A:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus} tsqfekrgvainvpqwvpenciqcnqcafvcphsailpvlakeeelvgapanftaleakg kelkgykfriqintldcmgcgncadicppkekalvmqpldtqrdaqvpnleyaarip
Timeline for d2pdaa5: