Lineage for d1b0pb5 (1b0p B:669-785)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2555939Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2556102Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 2556228Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain V [54889] (1 species)
  7. 2556229Species Desulfovibrio africanus [TaxId:873] [54890] (10 PDB entries)
  8. 2556243Domain d1b0pb5: 1b0p B:669-785 [39004]
    Other proteins in same PDB: d1b0pa1, d1b0pa2, d1b0pa3, d1b0pa4, d1b0pb1, d1b0pb2, d1b0pb3, d1b0pb4
    complexed with ca, mg, sf4, tpp

Details for d1b0pb5

PDB Entry: 1b0p (more details), 2.31 Å

PDB Description: crystal structure of pyruvate-ferredoxin oxidoreductase from desulfovibrio africanus
PDB Compounds: (B:) protein (pyruvate-ferredoxin oxidoreductase)

SCOPe Domain Sequences for d1b0pb5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b0pb5 d.58.1.5 (B:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus [TaxId: 873]}
tsqfekrgvainvpqwvpenciqcnqcafvcphsailpvlakeeelvgapanftaleakg
kelkgykfriqintldcmgcgncadicppkekalvmqpldtqrdaqvpnleyaarip

SCOPe Domain Coordinates for d1b0pb5:

Click to download the PDB-style file with coordinates for d1b0pb5.
(The format of our PDB-style files is described here.)

Timeline for d1b0pb5: