Lineage for d1b0pb5 (1b0p B:669-785)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 80004Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 80005Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) (S)
  5. 80087Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (4 proteins)
  6. 80107Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain V [54889] (1 species)
  7. 80108Species Desulfovibrio africanus [TaxId:873] [54890] (2 PDB entries)
  8. 80110Domain d1b0pb5: 1b0p B:669-785 [39004]
    Other proteins in same PDB: d1b0pa1, d1b0pa2, d1b0pa3, d1b0pa4, d1b0pb1, d1b0pb2, d1b0pb3, d1b0pb4

Details for d1b0pb5

PDB Entry: 1b0p (more details), 2.31 Å

PDB Description: crystal structure of pyruvate-ferredoxin oxidoreductase from desulfovibrio africanus

SCOP Domain Sequences for d1b0pb5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b0pb5 d.58.1.5 (B:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus}
tsqfekrgvainvpqwvpenciqcnqcafvcphsailpvlakeeelvgapanftaleakg
kelkgykfriqintldcmgcgncadicppkekalvmqpldtqrdaqvpnleyaarip

SCOP Domain Coordinates for d1b0pb5:

Click to download the PDB-style file with coordinates for d1b0pb5.
(The format of our PDB-style files is described here.)

Timeline for d1b0pb5: