SCOPe 2.07: Domain d7csna1: 7csn A:1-193

Lineage for d7csna1 (7csn A:1-193)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families)

5. Family c.56.3.0: automated matches [193325] (1 protein)
   not a true family

6. Protein automated matches [193326] (11 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:575584] [196867] (29 PDB entries)

8. Domain d7csna1: 7csn A:1-193 [390023]
   Other proteins in same PDB: d7csna2
   automated match to d4qaja_

Details for d7csna1

PDB Entry: 7csn, 1 Å

PDB Description: crystal structure of peptidyl-trna hydrolase from acinetobacter baumannii at 1.00 a resolution

PDB Compounds: (A:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d7csna1:

Sequence; same for both SEQRES and ATOM records:

>d7csna1 c.56.3.0 (A:1-193) automated matches {Acinetobacter baumannii [TaxId: 575584]}
msnislivglgnpgseyaqtrhnagfwfveqladkygitlkndpkfhgisgrgnieghdv
rlllpmtymnrsgqsvvpfskfyqiapeailiahdeldmnpgvirlktggghgghnglrd
ivphigpnfhrlrigighpgskervsghvlgkapsneqslmdgaidhalskvkllvqgqv
pqamnqinaykpa

Timeline for d7csna1:

• d7csna1 is new in SCOPe 2.07-stable
  
• d7csna1 appears in the current release, SCOPe 2.08