![]() | Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (48 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) ![]() |
![]() | Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (7 proteins) members of this "family" may be more closely related to other ferredoxins than to each other |
![]() | Protein Fe-only hydrogenase larger subunit, N-domain [54887] (1 species) |
![]() | Species Desulfovibrio desulfuricans [TaxId:876] [54888] (1 PDB entry) |
![]() | Domain d1hfem2: 1hfe M:2-86 [39002] Other proteins in same PDB: d1hfel1, d1hfem1, d1hfes_, d1hfet_ complexed with cmo, cyn, fcy, fe2, fs4, pdt, zn |
PDB Entry: 1hfe (more details), 1.6 Å
SCOP Domain Sequences for d1hfem2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hfem2 d.58.1.5 (M:2-86) Fe-only hydrogenase larger subunit, N-domain {Desulfovibrio desulfuricans} srtvmerieyemhtpdpkadpdklhfvqideakcigcdtcsqycptaaifgemgephsip hieacincgqclthcpenaiyeaqs
Timeline for d1hfem2:
![]() Domains from other chains: (mouse over for more information) d1hfel1, d1hfel2, d1hfes_, d1hfet_ |