Lineage for d1hfem2 (1hfe M:2-86)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 328742Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 328743Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) (S)
  5. 328830Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (7 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 328859Protein Fe-only hydrogenase larger subunit, N-domain [54887] (1 species)
  7. 328860Species Desulfovibrio desulfuricans [TaxId:876] [54888] (1 PDB entry)
  8. 328862Domain d1hfem2: 1hfe M:2-86 [39002]
    Other proteins in same PDB: d1hfel1, d1hfem1, d1hfes_, d1hfet_
    complexed with cmo, cyn, fcy, fe2, fs4, pdt, zn

Details for d1hfem2

PDB Entry: 1hfe (more details), 1.6 Å

PDB Description: 1.6 a resolution structure of the fe-only hydrogenase from desulfovibrio desulfuricans

SCOP Domain Sequences for d1hfem2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hfem2 d.58.1.5 (M:2-86) Fe-only hydrogenase larger subunit, N-domain {Desulfovibrio desulfuricans}
srtvmerieyemhtpdpkadpdklhfvqideakcigcdtcsqycptaaifgemgephsip
hieacincgqclthcpenaiyeaqs

SCOP Domain Coordinates for d1hfem2:

Click to download the PDB-style file with coordinates for d1hfem2.
(The format of our PDB-style files is described here.)

Timeline for d1hfem2: