Lineage for d1c4ca3 (1c4c A:127-209)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 80004Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 80005Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) (S)
  5. 80087Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (4 proteins)
  6. 80102Protein Fe-only hydrogenase, second domain [54885] (1 species)
  7. 80103Species Clostridium pasteurianum [TaxId:1501] [54886] (3 PDB entries)
  8. 80105Domain d1c4ca3: 1c4c A:127-209 [38999]
    Other proteins in same PDB: d1c4ca1, d1c4ca2

Details for d1c4ca3

PDB Entry: 1c4c (more details), 2.4 Å

PDB Description: binding of exogenously added carbon monoxide at the active site of the fe-only hydrogenase (cpi) from clostridium pasteurianum

SCOP Domain Sequences for d1c4ca3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c4ca3 d.58.1.5 (A:127-209) Fe-only hydrogenase, second domain {Clostridium pasteurianum}
kdkteyvdersksltvdrtkcllcgrcvnacgkntetyamkflnkngktiigaedekcfd
dtncllcgqciiacpvaalseks

SCOP Domain Coordinates for d1c4ca3:

Click to download the PDB-style file with coordinates for d1c4ca3.
(The format of our PDB-style files is described here.)

Timeline for d1c4ca3: