Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.58: Ferredoxin-like [54861] (36 superfamilies) |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) |
Family d.58.1.4: Single 4Fe-4S cluster ferredoxin [54877] (3 proteins) |
Protein Ferredoxin [54882] (1 species) |
Species Bacillus thermoproteolyticus [TaxId:1427] [54883] (1 PDB entry) |
Domain d2fxb__: 2fxb - [38997] |
PDB Entry: 2fxb (more details), 2.3 Å
SCOP Domain Sequences for d2fxb__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fxb__ d.58.1.4 (-) Ferredoxin {Bacillus thermoproteolyticus} pkytivdketciacgacgaaapdiydydedgiayvtlddnqgivevpdiliddmmdafeg cptdsikvadepfdgdpnkfe
Timeline for d2fxb__: