SCOPe 2.08: Domain d6ypha_: 6yph A:

Lineage for d6ypha_ (6yph A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Protein kinase CK2, alpha subunit [56142] (3 species)
   CMGC group; CK2 subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [75559] (184 PDB entries)

8. Domain d6ypha_: 6yph A: [389570]
   automated match to d5cu6a_
   complexed with n5q

Details for d6ypha_

PDB Entry: 6yph, 1.67 Å

PDB Description: crystal structure of ck2alpha with compound 2 bound

PDB Compounds: (A:) Casein kinase II subunit alpha

SCOPe Domain Sequences for d6ypha_:

Sequence; same for both SEQRES and ATOM records:

>d6ypha_ d.144.1.7 (A:) Protein kinase CK2, alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
sgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainitn
nekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdf
kqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaef
yhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydq
lvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfl
dkllrydhqsrltareamehpyfytv

Timeline for d6ypha_:

• d6ypha_ first appeared in SCOPe 2.07