SCOPe 2.08: Domain d6wdtl_: 6wdt L:

Lineage for d6wdtl_ (6wdt L:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)

8. Domain d6wdtl_: 6wdt L: [389562]
   Other proteins in same PDB: d6wdta_, d6wdtc_, d6wdth2
   automated match to d1fgvl_

Details for d6wdtl_

PDB Entry: 6wdt, 3.1 Å

PDB Description: enterovirus d68 in complex with human monoclonal antibody ev68-228

PDB Compounds: (L:) EV68-228 light chain

SCOPe Domain Sequences for d6wdtl_:

Sequence, based on SEQRES records:

>d6wdtl_ b.1.1.1 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqmtqspssvsasvgdrvtltcrasqdisswlawyqqkpgkapklliyaasslqsgvpsr
fsgsgsgthftltisslqpedfatyfcqqadsfitfgggtk

Sequence, based on observed residues (ATOM records):

>d6wdtl_ b.1.1.1 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqmtqspssvsasvgdrvtltcrasqdisswlawyqqkpgkapklliyaasslqsgvpsr
fsgsgsgthftltisslqfatyfcqqadsfitfgggtk

Timeline for d6wdtl_:

• d6wdtl_ first appeared in SCOPe 2.07