Lineage for d6xxwa1 (6xxw A:1-173)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775079Species Dictyoglomus thermophilum [TaxId:309799] [389548] (1 PDB entry)
  8. 2775080Domain d6xxwa1: 6xxw A:1-173 [389549]
    Other proteins in same PDB: d6xxwa2, d6xxwa3
    automated match to d3lpfa1
    complexed with cl, mpd, trs

Details for d6xxwa1

PDB Entry: 6xxw (more details), 1.85 Å

PDB Description: structure of beta-d-glucuronidase for dictyoglomus thermophilum.
PDB Compounds: (A:) beta-glucuronidase

SCOPe Domain Sequences for d6xxwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xxwa1 b.18.1.0 (A:1-173) automated matches {Dictyoglomus thermophilum [TaxId: 309799]}
mlypkesetrevkdlsgvwefrtesdknyilmpvpasfnditqdinlrdyvgrvyykksf
fipvywkerniflrvgaaahfsevyvngnlvtkhkggflpfeaeiskfvnygqeniieim
vdntltwdvlppgelkviedemhpkgykvlnyyfdffnysgihrpvviyttpk

SCOPe Domain Coordinates for d6xxwa1:

Click to download the PDB-style file with coordinates for d6xxwa1.
(The format of our PDB-style files is described here.)

Timeline for d6xxwa1: