Class b: All beta proteins [48724] (180 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (51 species) not a true protein |
Species Dictyoglomus thermophilum [TaxId:309799] [389548] (1 PDB entry) |
Domain d6xxwa1: 6xxw A:1-173 [389549] Other proteins in same PDB: d6xxwa2, d6xxwa3 automated match to d3lpfa1 complexed with cl, mpd, trs |
PDB Entry: 6xxw (more details), 1.85 Å
SCOPe Domain Sequences for d6xxwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6xxwa1 b.18.1.0 (A:1-173) automated matches {Dictyoglomus thermophilum [TaxId: 309799]} mlypkesetrevkdlsgvwefrtesdknyilmpvpasfnditqdinlrdyvgrvyykksf fipvywkerniflrvgaaahfsevyvngnlvtkhkggflpfeaeiskfvnygqeniieim vdntltwdvlppgelkviedemhpkgykvlnyyfdffnysgihrpvviyttpk
Timeline for d6xxwa1: