Lineage for d6vn1m_ (6vn1 M:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2743151Domain d6vn1m_: 6vn1 M: [389515]
    Other proteins in same PDB: d6vn1a_, d6vn1b_, d6vn1c_, d6vn1h_, d6vn1i_, d6vn1j_
    automated match to d4l1ha_

Details for d6vn1m_

PDB Entry: 6vn1 (more details), 2.8 Å

PDB Description: a 2.8 angstrom cryo-em structure of a glycoprotein b-neutralizing antibody complex reveals a critical domain for herpesvirus fusion initiation
PDB Compounds: (M:) Human monoclonal antibody 93k variable light chain

SCOPe Domain Sequences for d6vn1m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vn1m_ b.1.1.1 (M:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspstlsasvgdrvtitcrasqtistwlawyqqtprkapklmiykasilengvps
rfsgsgsgteftltisslqpedfatyycqqyksypwtfgqgtkvei

SCOPe Domain Coordinates for d6vn1m_:

Click to download the PDB-style file with coordinates for d6vn1m_.
(The format of our PDB-style files is described here.)

Timeline for d6vn1m_: