Lineage for d6vn1h_ (6vn1 H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2757653Domain d6vn1h_: 6vn1 H: [389490]
    Other proteins in same PDB: d6vn1a_, d6vn1b_, d6vn1c_, d6vn1l_, d6vn1m_, d6vn1n_
    automated match to d5c2bh_

Details for d6vn1h_

PDB Entry: 6vn1 (more details), 2.8 Å

PDB Description: a 2.8 angstrom cryo-em structure of a glycoprotein b-neutralizing antibody complex reveals a critical domain for herpesvirus fusion initiation
PDB Compounds: (H:) Human monoclonal antibody 93k variable heavy chain

SCOPe Domain Sequences for d6vn1h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vn1h_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqlvqsgaevkkpgssvkvsckasggtfsnfaiswvrqapgqglewmgrimplfvtsty
aqkfqgrvtisadaststaymelsslrsddtamyycarditapgaaptplnfygmdvwgq
gttvtvss

SCOPe Domain Coordinates for d6vn1h_:

Click to download the PDB-style file with coordinates for d6vn1h_.
(The format of our PDB-style files is described here.)

Timeline for d6vn1h_: