Lineage for d6u9dr1 (6u9d R:84-274)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2472772Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2472773Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2473412Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. 2473413Protein automated matches [227126] (21 species)
    not a true protein
  7. 2473445Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255615] (5 PDB entries)
  8. 2473474Domain d6u9dr1: 6u9d R:84-274 [389468]
    automated match to d1jscb2
    complexed with 60g, atp, fad, mg, tpp

Details for d6u9dr1

PDB Entry: 6u9d (more details), 3.19 Å

PDB Description: saccharomyces cerevisiae acetohydroxyacid synthase
PDB Compounds: (R:) Acetolactate synthase catalytic subunit, mitochondrial

SCOPe Domain Sequences for d6u9dr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6u9dr1 c.36.1.0 (R:84-274) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dmdtsfvgltggqifnemmsrqnvdtvfgypggailpvydaihnsdkfnfvlpkheqgag
hmaegyarasgkpgvvlvtsgpgatnvvtpmadafadgipmvvftgqvptsaigtdafqe
advvgisrsctkwnvmvksveelplrineafeiatsgrpgpvlvdlpkdvtaailrnpip
tkttlpsnaln

SCOPe Domain Coordinates for d6u9dr1:

Click to download the PDB-style file with coordinates for d6u9dr1.
(The format of our PDB-style files is described here.)

Timeline for d6u9dr1: