Lineage for d6rxbd2 (6rxb D:68-208)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2727850Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2727851Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2728262Family a.121.1.0: automated matches [227226] (1 protein)
    not a true family
  6. 2728263Protein automated matches [226967] (6 species)
    not a true protein
  7. 2728264Species Acinetobacter baumannii [TaxId:509173] [389358] (2 PDB entries)
  8. 2728270Domain d6rxbd2: 6rxb D:68-208 [389410]
    Other proteins in same PDB: d6rxba1, d6rxbb1, d6rxbb3, d6rxbc1, d6rxbd1, d6rxbd3
    automated match to d2ns7a2
    complexed with cl, edo, mg, miy, sin

Details for d6rxbd2

PDB Entry: 6rxb (more details), 2.25 Å

PDB Description: crystal structure of tetr-q116a from acinetobacter baumannii aye in complex with minocycline
PDB Compounds: (D:) Tetracycline repressor protein class G

SCOPe Domain Sequences for d6rxbd2:

Sequence, based on SEQRES records: (download)

>d6rxbd2 a.121.1.0 (D:68-208) automated matches {Acinetobacter baumannii [TaxId: 509173]}
lpeenedwrvflkenalsfrtallsyrdgarihagtrptepnfgtaetairflcaegfcp
kravwalravshyvvgsvleqqasdadervpdrpdvseqapssflhdlfheletdgmdaa
fnfgldsliagferlrssttd

Sequence, based on observed residues (ATOM records): (download)

>d6rxbd2 a.121.1.0 (D:68-208) automated matches {Acinetobacter baumannii [TaxId: 509173]}
lpeenedwrvflkenalsfrtallsyrdgarihagtrptepnfgtaetairflcaegfcp
kravwalravshyvvgsvleqqasdadelhdlfhelmdaafnfgldsliagferlrsstt
d

SCOPe Domain Coordinates for d6rxbd2:

Click to download the PDB-style file with coordinates for d6rxbd2.
(The format of our PDB-style files is described here.)

Timeline for d6rxbd2: