Lineage for d6shga_ (6shg A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2369776Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)
  8. 2371392Domain d6shga_: 6shg A: [389392]
    Other proteins in same PDB: d6shgh_
    automated match to d4q9ca_

Details for d6shga_

PDB Entry: 6shg (more details), 3.09 Å

PDB Description: diffraction data for roab13 crystal co-crystallised with piydin and its roab13 structure
PDB Compounds: (A:) RoAb13 Fab Light chain (Constant domain)

SCOPe Domain Sequences for d6shga_:

Sequence, based on SEQRES records: (download)

>d6shga_ b.1.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnr

Sequence, based on observed residues (ATOM records): (download)

>d6shga_ b.1.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkerqngvlnswtdqdskdstys
msstltltkdeyerhnsytceathktstspivksfnr

SCOPe Domain Coordinates for d6shga_:

Click to download the PDB-style file with coordinates for d6shga_.
(The format of our PDB-style files is described here.)

Timeline for d6shga_:

  • d6shga_ is new in SCOPe 2.07-stable
  • d6shga_ does not appear in SCOPe 2.08