SCOP 1.65: Domain d1a6eb3: 1a6e B:145-215,B:368-403

Lineage for d1a6eb3 (1a6e B:145-215,B:368-403)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.56: GroEL-intermediate domain like [54848] (1 superfamily)
   3-helical bundle packed against 3-stranded mixed beta-sheet

4. Superfamily d.56.1: GroEL-intermediate domain like [54849] (2 families)

5. Family d.56.1.2: Group II chaperonin (CCT, TRIC), intermediate domain [54853] (1 protein)

6. Protein Thermosome, I domain [54854] (1 species)

7. Species Archaeon Thermoplasma acidophilum [TaxId:2303] [54855] (2 PDB entries)

8. Domain d1a6eb3: 1a6e B:145-215,B:368-403 [38939]
   Other proteins in same PDB: d1a6ea1, d1a6ea2, d1a6eb1, d1a6eb2
   complexed with adp, af3, mg

Details for d1a6eb3

PDB Entry: 1a6e, 3.2 Å

PDB Description: thermosome-mg-adp-alf3 complex

SCOP Domain Sequences for d1a6eb3:

Sequence; same for both SEQRES and ATOM records:

>d1a6eb3 d.56.1.2 (B:145-215,B:368-403) Thermosome, I domain {Archaeon Thermoplasma acidophilum}
gadekalllkmaqtslnsksasvakdklaeisyeavksvaelrdgkyyvdfdniqvvkkq
ggaiddtqlinXkavsilvrgetehvvdemersitdslhvvasaledg

Timeline for d1a6eb3:

• d1a6eb3 first appeared (with stable ids) in SCOP 1.55
  
• d1a6eb3 appears in SCOP 1.63
  
• d1a6eb3 appears in SCOP 1.67
  
• d1a6eb3 appears in the current release, SCOPe 2.08