Lineage for d6shgh_ (6shg H:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2356330Species Mouse (Mus musculus) [TaxId:10090] [186842] (212 PDB entries)
  8. 2356726Domain d6shgh_: 6shg H: [389383]
    Other proteins in same PDB: d6shga_, d6shgl_
    automated match to d3ab0b_

Details for d6shgh_

PDB Entry: 6shg (more details), 3.09 Å

PDB Description: diffraction data for roab13 crystal co-crystallised with piydin and its roab13 structure
PDB Compounds: (H:) RoAb13 Fab Heavy chain (Variable domain)

SCOPe Domain Sequences for d6shgh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6shgh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqesggglvkpggslklscaasgftfstyamswvrqtpekrlewvasistgdntyyt
dsvrgrftisrdnarnilylqmsslrsedtamyfctrgrgdrgdlfgywgqgtlvtvss

SCOPe Domain Coordinates for d6shgh_:

Click to download the PDB-style file with coordinates for d6shgh_.
(The format of our PDB-style files is described here.)

Timeline for d6shgh_: