| Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
| Fold d.56: GroEL-like chaperone, intermediate domain [54848] (1 superfamily) |
Superfamily d.56.1: GroEL-like chaperone, intermediate domain [54849] (2 families) ![]() |
| Family d.56.1.2: Group II chaperonin (CCT, TRIC) [54853] (1 protein) |
| Protein Thermosome [54854] (1 species) |
| Species Archaeon Thermoplasma acidophilum [TaxId:2303] [54855] (2 PDB entries) |
| Domain d1a6db3: 1a6d B:145-215,B:368-403 [38937] Other proteins in same PDB: d1a6da1, d1a6da2, d1a6db1, d1a6db2 |
PDB Entry: 1a6d (more details), 2.6 Å
SCOP Domain Sequences for d1a6db3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a6db3 d.56.1.2 (B:145-215,B:368-403) Thermosome {Archaeon Thermoplasma acidophilum}
gadekalllkmaqtslnsksasvakdklaeisyeavksvaelrdgkyyvdfdniqvvkkq
ggaiddtqlinXkavsilvrgetehvvdemersitdslhvvasaledg
Timeline for d1a6db3: