![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (20 families) ![]() consists only of helices |
![]() | Family a.4.1.0: automated matches [191447] (1 protein) not a true family |
![]() | Protein automated matches [190674] (25 species) not a true protein |
![]() | Species Acinetobacter baumannii [TaxId:509173] [389356] (1 PDB entry) |
![]() | Domain d6rxbb1: 6rxb B:3-67 [389364] Other proteins in same PDB: d6rxba2, d6rxbb2, d6rxbb3, d6rxbc2, d6rxbd2, d6rxbd3 automated match to d2ns7a1 complexed with cl, edo, mg, miy, sin |
PDB Entry: 6rxb (more details), 2.25 Å
SCOPe Domain Sequences for d6rxbb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6rxbb1 a.4.1.0 (B:3-67) automated matches {Acinetobacter baumannii [TaxId: 509173]} kldkgtviaaalellnevgmdslttrklaerlkvqqpalywhfqnkralldalaeamlae rhtrs
Timeline for d6rxbb1: