SCOPe 2.08: Domain d6rxbb1: 6rxb B:3-67

Lineage for d6rxbb1 (6rxb B:3-67)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.0: automated matches [191447] (1 protein)
   not a true family

6. Protein automated matches [190674] (25 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:509173] [389356] (2 PDB entries)

8. Domain d6rxbb1: 6rxb B:3-67 [389364]
   Other proteins in same PDB: d6rxba2, d6rxbb2, d6rxbb3, d6rxbc2, d6rxbd2, d6rxbd3
   automated match to d2ns7a1
   complexed with cl, edo, mg, miy, sin

Details for d6rxbb1

PDB Entry: 6rxb, 2.25 Å

PDB Description: crystal structure of tetr-q116a from acinetobacter baumannii aye in complex with minocycline

PDB Compounds: (B:) Tetracycline repressor protein class G

SCOPe Domain Sequences for d6rxbb1:

Sequence; same for both SEQRES and ATOM records:

>d6rxbb1 a.4.1.0 (B:3-67) automated matches {Acinetobacter baumannii [TaxId: 509173]}
kldkgtviaaalellnevgmdslttrklaerlkvqqpalywhfqnkralldalaeamlae
rhtrs

Timeline for d6rxbb1:

• d6rxbb1 first appeared in SCOPe 2.07