SCOP 1.59: Domain d1aonl3: 1aon L:137-190,L:367-409

Lineage for d1aonl3 (1aon L:137-190,L:367-409)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.56: GroEL-like chaperone, intermediate domain [54848] (1 superfamily)

4. Superfamily d.56.1: GroEL-like chaperone, intermediate domain [54849] (2 families)

5. Family d.56.1.1: GroEL [54850] (1 protein)

6. Protein GroEL [54851] (2 species)

7. Species Escherichia coli [TaxId:562] [54852] (4 PDB entries)

8. Domain d1aonl3: 1aon L:137-190,L:367-409 [38932]
   Other proteins in same PDB: d1aona1, d1aona2, d1aonb1, d1aonb2, d1aonc1, d1aonc2, d1aond1, d1aond2, d1aone1, d1aone2, d1aonf1, d1aonf2, d1aong1, d1aong2, d1aonh1, d1aonh2, d1aoni1, d1aoni2, d1aonj1, d1aonj2, d1aonk1, d1aonk2, d1aonl1, d1aonl2, d1aonm1, d1aonm2, d1aonn1, d1aonn2, d1aono_, d1aonp_, d1aonq_, d1aonr_, d1aons_, d1aont_, d1aonu_

Details for d1aonl3

PDB Entry: 1aon, 3 Å

PDB Description: crystal structure of the asymmetric chaperonin complex groel/groes/(adp)7

SCOP Domain Sequences for d1aonl3:

Sequence; same for both SEQRES and ATOM records:

>d1aonl3 d.56.1.1 (L:137-190,L:367-409) GroEL {Escherichia coli}
pcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgtglqdeldvvXervak
laggvavikvgaatevemkekkarvedalhatraavee

Timeline for d1aonl3:

• d1aonl3 first appeared (with stable ids) in SCOP 1.55
  
• d1aonl3 appears in SCOP 1.57
  
• d1aonl3 appears in SCOP 1.61
  
• d1aonl3 appears in the current release, SCOPe 2.08