Lineage for d1aonk3 (1aon K:137-190,K:367-409)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.56: GroEL-like chaperone, intermediate domain [54848] (1 superfamily) Superfamily d.56.1: GroEL-like chaperone, intermediate domain [54849] (2 families) 
Family d.56.1.1: GroEL [54850] (1 protein) Protein GroEL [54851] (1 species) Species Escherichia coli [TaxId:562] [54852] (4 PDB entries) 
Domain d1aonk3: 1aon K:137-190,K:367-409 [38931]
Other proteins in same PDB: d1aona1, d1aona2, d1aonb1, d1aonb2, d1aonc1, d1aonc2, d1aond1, d1aond2, d1aone1, d1aone2, d1aonf1, d1aonf2, d1aong1, d1aong2, d1aonh1, d1aonh2, d1aoni1, d1aoni2, d1aonj1, d1aonj2, d1aonk1, d1aonk2, d1aonl1, d1aonl2, d1aonm1, d1aonm2, d1aonn1, d1aonn2, d1aono_, d1aonp_, d1aonq_, d1aonr_, d1aons_, d1aont_, d1aonu_
Details for d1aonk3
PDB Entry: 1aon (more details), 3 Å
PDB Description: crystal structure of the asymmetric chaperonin complex groel/groes/(adp)7
SCOP Domain Sequences for d1aonk3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aonk3 d.56.1.1 (K:137-190,K:367-409) GroEL {Escherichia coli}
pcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgtglqdeldvvXervak
laggvavikvgaatevemkekkarvedalhatraavee
SCOP Domain Coordinates for d1aonk3:
Click to download the PDB-style file with coordinates for d1aonk3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1aonk3:
- d1aonk3 appears in SCOP 1.57
- d1aonk3 appears in the current release, SCOPe 2.08
 View in 3DDomains from other chains: (mouse over for more information) d1aona1, d1aona2, d1aona3, d1aonb1, d1aonb2, d1aonb3, d1aonc1, d1aonc2, d1aonc3, d1aond1, d1aond2, d1aond3, d1aone1, d1aone2, d1aone3, d1aonf1, d1aonf2, d1aonf3, d1aong1, d1aong2, d1aong3, d1aonh1, d1aonh2, d1aonh3, d1aoni1, d1aoni2, d1aoni3, d1aonj1, d1aonj2, d1aonj3, d1aonl1, d1aonl2, d1aonl3, d1aonm1, d1aonm2, d1aonm3, d1aonn1, d1aonn2, d1aonn3, d1aono_, d1aonp_, d1aonq_, d1aonr_, d1aons_, d1aont_, d1aonu_ |
