Lineage for d1aonh3 (1aon H:137-190,H:367-409)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 256999Fold d.56: GroEL-intermediate domain like [54848] (1 superfamily)
    3-helical bundle packed against 3-stranded mixed beta-sheet
  4. 257000Superfamily d.56.1: GroEL-intermediate domain like [54849] (2 families) (S)
  5. 257001Family d.56.1.1: GroEL-like chaperone, intermediate domain [54850] (1 protein)
  6. 257002Protein GroEL, I domain [54851] (2 species)
  7. 257003Species Escherichia coli [TaxId:562] [54852] (4 PDB entries)
  8. 257032Domain d1aonh3: 1aon H:137-190,H:367-409 [38928]
    Other proteins in same PDB: d1aona1, d1aona2, d1aonb1, d1aonb2, d1aonc1, d1aonc2, d1aond1, d1aond2, d1aone1, d1aone2, d1aonf1, d1aonf2, d1aong1, d1aong2, d1aonh1, d1aonh2, d1aoni1, d1aoni2, d1aonj1, d1aonj2, d1aonk1, d1aonk2, d1aonl1, d1aonl2, d1aonm1, d1aonm2, d1aonn1, d1aonn2, d1aono_, d1aonp_, d1aonq_, d1aonr_, d1aons_, d1aont_, d1aonu_

Details for d1aonh3

PDB Entry: 1aon (more details), 3 Å

PDB Description: crystal structure of the asymmetric chaperonin complex groel/groes/(adp)7

SCOP Domain Sequences for d1aonh3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aonh3 d.56.1.1 (H:137-190,H:367-409) GroEL, I domain {Escherichia coli}
pcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgtglqdeldvvXervak
laggvavikvgaatevemkekkarvedalhatraavee

SCOP Domain Coordinates for d1aonh3:

Click to download the PDB-style file with coordinates for d1aonh3.
(The format of our PDB-style files is described here.)

Timeline for d1aonh3:

View in 3D
Domains from other chains:
(mouse over for more information)
d1aona1, d1aona2, d1aona3, d1aonb1, d1aonb2, d1aonb3, d1aonc1, d1aonc2, d1aonc3, d1aond1, d1aond2, d1aond3, d1aone1, d1aone2, d1aone3, d1aonf1, d1aonf2, d1aonf3, d1aong1, d1aong2, d1aong3, d1aoni1, d1aoni2, d1aoni3, d1aonj1, d1aonj2, d1aonj3, d1aonk1, d1aonk2, d1aonk3, d1aonl1, d1aonl2, d1aonl3, d1aonm1, d1aonm2, d1aonm3, d1aonn1, d1aonn2, d1aonn3, d1aono_, d1aonp_, d1aonq_, d1aonr_, d1aons_, d1aont_, d1aonu_