SCOPe 2.08: Domain d6kfta_: 6kft A:

Lineage for d6kfta_ (6kft A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Ran [52609] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52611] (90 PDB entries)

8. Domain d6kfta_: 6kft A: [389266]
   Other proteins in same PDB: d6kftb_
   automated match to d2mmca_
   complexed with edo, gol, gtp, mg, na; mutant
   has additional insertions and/or extensions that are not grouped together

Details for d6kfta_

PDB Entry: 6kft, 2.51 Å

PDB Description: mvm ns2 mutant nm42 in complex with crm1-ran-ranbp1

PDB Compounds: (A:) GTP-binding nuclear protein ran

SCOPe Domain Sequences for d6kfta_:

Sequence; same for both SEQRES and ATOM records:

>d6kfta_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]}
pqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdt
agqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdi
kdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappe
vvmdpalaaqaehdlevaqttalpdedddl

Timeline for d6kfta_:

• d6kfta_ first appeared in SCOPe 2.07