Lineage for d1aonb3 (1aon B:137-190,B:367-409)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 256999Fold d.56: GroEL-intermediate domain like [54848] (1 superfamily)
    3-helical bundle packed against 3-stranded mixed beta-sheet
  4. 257000Superfamily d.56.1: GroEL-intermediate domain like [54849] (2 families) (S)
  5. 257001Family d.56.1.1: GroEL-like chaperone, intermediate domain [54850] (1 protein)
  6. 257002Protein GroEL, I domain [54851] (2 species)
  7. 257003Species Escherichia coli [TaxId:562] [54852] (4 PDB entries)
  8. 257026Domain d1aonb3: 1aon B:137-190,B:367-409 [38922]
    Other proteins in same PDB: d1aona1, d1aona2, d1aonb1, d1aonb2, d1aonc1, d1aonc2, d1aond1, d1aond2, d1aone1, d1aone2, d1aonf1, d1aonf2, d1aong1, d1aong2, d1aonh1, d1aonh2, d1aoni1, d1aoni2, d1aonj1, d1aonj2, d1aonk1, d1aonk2, d1aonl1, d1aonl2, d1aonm1, d1aonm2, d1aonn1, d1aonn2, d1aono_, d1aonp_, d1aonq_, d1aonr_, d1aons_, d1aont_, d1aonu_

Details for d1aonb3

PDB Entry: 1aon (more details), 3 Å

PDB Description: crystal structure of the asymmetric chaperonin complex groel/groes/(adp)7

SCOP Domain Sequences for d1aonb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aonb3 d.56.1.1 (B:137-190,B:367-409) GroEL, I domain {Escherichia coli}
pcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgtglqdeldvvXervak
laggvavikvgaatevemkekkarvedalhatraavee

SCOP Domain Coordinates for d1aonb3:

Click to download the PDB-style file with coordinates for d1aonb3.
(The format of our PDB-style files is described here.)

Timeline for d1aonb3:

View in 3D
Domains from other chains:
(mouse over for more information)
d1aona1, d1aona2, d1aona3, d1aonc1, d1aonc2, d1aonc3, d1aond1, d1aond2, d1aond3, d1aone1, d1aone2, d1aone3, d1aonf1, d1aonf2, d1aonf3, d1aong1, d1aong2, d1aong3, d1aonh1, d1aonh2, d1aonh3, d1aoni1, d1aoni2, d1aoni3, d1aonj1, d1aonj2, d1aonj3, d1aonk1, d1aonk2, d1aonk3, d1aonl1, d1aonl2, d1aonl3, d1aonm1, d1aonm2, d1aonm3, d1aonn1, d1aonn2, d1aonn3, d1aono_, d1aonp_, d1aonq_, d1aonr_, d1aons_, d1aont_, d1aonu_