Lineage for d1aona3 (1aon A:137-190,A:367-409)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2948832Fold d.56: GroEL-intermediate domain like [54848] (1 superfamily)
    3-helical bundle packed against 3-stranded mixed beta-sheet
  4. 2948833Superfamily d.56.1: GroEL-intermediate domain like [54849] (2 families) (S)
  5. 2948834Family d.56.1.1: GroEL-like chaperone, intermediate domain [54850] (1 protein)
  6. 2948835Protein GroEL, I domain [54851] (4 species)
  7. 2948836Species Escherichia coli [TaxId:562] [54852] (11 PDB entries)
  8. 2948900Domain d1aona3: 1aon A:137-190,A:367-409 [38921]
    Other proteins in same PDB: d1aona1, d1aona2, d1aonb1, d1aonb2, d1aonc1, d1aonc2, d1aond1, d1aond2, d1aone1, d1aone2, d1aonf1, d1aonf2, d1aong1, d1aong2, d1aonh1, d1aonh2, d1aoni1, d1aoni2, d1aonj1, d1aonj2, d1aonk1, d1aonk2, d1aonl1, d1aonl2, d1aonm1, d1aonm2, d1aonn1, d1aonn2, d1aono_, d1aonp_, d1aonq_, d1aonr_, d1aons_, d1aont_, d1aonu_
    complexed with adp, mg

Details for d1aona3

PDB Entry: 1aon (more details), 3 Å

PDB Description: crystal structure of the asymmetric chaperonin complex groel/groes/(adp)7
PDB Compounds: (A:) groEL

SCOPe Domain Sequences for d1aona3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aona3 d.56.1.1 (A:137-190,A:367-409) GroEL, I domain {Escherichia coli [TaxId: 562]}
pcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgtglqdeldvvXervak
laggvavikvgaatevemkekkarvedalhatraavee

SCOPe Domain Coordinates for d1aona3:

Click to download the PDB-style file with coordinates for d1aona3.
(The format of our PDB-style files is described here.)

Timeline for d1aona3:

View in 3D
Domains from other chains:
(mouse over for more information)
d1aonb1, d1aonb2, d1aonb3, d1aonc1, d1aonc2, d1aonc3, d1aond1, d1aond2, d1aond3, d1aone1, d1aone2, d1aone3, d1aonf1, d1aonf2, d1aonf3, d1aong1, d1aong2, d1aong3, d1aonh1, d1aonh2, d1aonh3, d1aoni1, d1aoni2, d1aoni3, d1aonj1, d1aonj2, d1aonj3, d1aonk1, d1aonk2, d1aonk3, d1aonl1, d1aonl2, d1aonl3, d1aonm1, d1aonm2, d1aonm3, d1aonn1, d1aonn2, d1aonn3, d1aono_, d1aonp_, d1aonq_, d1aonr_, d1aons_, d1aont_, d1aonu_