Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.48: TK C-terminal domain-like [52921] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest |
Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) |
Family c.48.1.0: automated matches [227237] (1 protein) not a true family |
Protein automated matches [226991] (9 species) not a true protein |
Species Escherichia coli [TaxId:83333] [324642] (4 PDB entries) |
Domain d6tj9b3: 6tj9 B:528-663 [389125] Other proteins in same PDB: d6tj9a1, d6tj9a2, d6tj9a4, d6tj9b1, d6tj9b2, d6tj9b4 automated match to d2r8oa3 complexed with 5sp, ca, edo, na, ndq |
PDB Entry: 6tj9 (more details), 0.95 Å
SCOPe Domain Sequences for d6tj9b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6tj9b3 c.48.1.0 (B:528-663) automated matches {Escherichia coli [TaxId: 83333]} rteeqlaniarggyvlkdcagqpelifiatgsevelavaayekltaegvkarvvsmpstd afdkqdaayresvlpkavtarvaveagiadywykyvglngaivgmttfgesapaellfee fgftvdnvvakakell
Timeline for d6tj9b3:
View in 3D Domains from other chains: (mouse over for more information) d6tj9a1, d6tj9a2, d6tj9a3, d6tj9a4 |