SCOPe 2.04: Domain d1oelg3: 1oel G:137-190,G:367-409

Lineage for d1oelg3 (1oel G:137-190,G:367-409)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.56: GroEL-intermediate domain like [54848] (1 superfamily)
   3-helical bundle packed against 3-stranded mixed beta-sheet

4. Superfamily d.56.1: GroEL-intermediate domain like [54849] (2 families)

5. Family d.56.1.1: GroEL-like chaperone, intermediate domain [54850] (1 protein)

6. Protein GroEL, I domain [54851] (4 species)

7. Species Escherichia coli [TaxId:562] [54852] (11 PDB entries)

8. Domain d1oelg3: 1oel G:137-190,G:367-409 [38906]
   Other proteins in same PDB: d1oela1, d1oela2, d1oelb1, d1oelb2, d1oelc3, d1oelc5, d1oeld1, d1oeld2, d1oele1, d1oele2, d1oelf1, d1oelf2, d1oelg1, d1oelg2

Details for d1oelg3

PDB Entry: 1oel, 2.8 Å

PDB Description: conformational variability in the refined structure of the chaperonin groel at 2.8 angstrom resolution

PDB Compounds: (G:) groEL (hsp60 class)

SCOPe Domain Sequences for d1oelg3:

Sequence; same for both SEQRES and ATOM records:

>d1oelg3 d.56.1.1 (G:137-190,G:367-409) GroEL, I domain {Escherichia coli [TaxId: 562]}
pcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgtglqdeldvvXervak
laggvavikvgaatevemkekkarvedalhatraavee

Timeline for d1oelg3:

• d1oelg3 first appeared (with stable ids) in SCOP 1.55
  
• d1oelg3 appears in SCOPe 2.03
  
• d1oelg3 appears in SCOPe 2.05
  
• d1oelg3 appears in the current release, SCOPe 2.08