Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.56: GroEL-intermediate domain like [54848] (1 superfamily) 3-helical bundle packed against 3-stranded mixed beta-sheet |
Superfamily d.56.1: GroEL-intermediate domain like [54849] (2 families) |
Family d.56.1.1: GroEL-like chaperone, intermediate domain [54850] (1 protein) |
Protein GroEL, I domain [54851] (4 species) |
Species Escherichia coli [TaxId:562] [54852] (9 PDB entries) |
Domain d1oelf3: 1oel F:137-190,F:367-409 [38905] Other proteins in same PDB: d1oela1, d1oela2, d1oelb1, d1oelb2, d1oelc3, d1oelc5, d1oeld1, d1oeld2, d1oele1, d1oele2, d1oelf1, d1oelf2, d1oelg1, d1oelg2 |
PDB Entry: 1oel (more details), 2.8 Å
SCOPe Domain Sequences for d1oelf3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oelf3 d.56.1.1 (F:137-190,F:367-409) GroEL, I domain {Escherichia coli [TaxId: 562]} pcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgtglqdeldvvXervak laggvavikvgaatevemkekkarvedalhatraavee
Timeline for d1oelf3: