Lineage for d1oelf3 (1oel F:137-190,F:367-409)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026296Fold d.56: GroEL-intermediate domain like [54848] (1 superfamily)
    3-helical bundle packed against 3-stranded mixed beta-sheet
  4. 1026297Superfamily d.56.1: GroEL-intermediate domain like [54849] (2 families) (S)
  5. 1026298Family d.56.1.1: GroEL-like chaperone, intermediate domain [54850] (1 protein)
  6. 1026299Protein GroEL, I domain [54851] (4 species)
  7. 1026300Species Escherichia coli [TaxId:562] [54852] (9 PDB entries)
  8. 1026320Domain d1oelf3: 1oel F:137-190,F:367-409 [38905]
    Other proteins in same PDB: d1oela1, d1oela2, d1oelb1, d1oelb2, d1oelc3, d1oelc5, d1oeld1, d1oeld2, d1oele1, d1oele2, d1oelf1, d1oelf2, d1oelg1, d1oelg2

Details for d1oelf3

PDB Entry: 1oel (more details), 2.8 Å

PDB Description: conformational variability in the refined structure of the chaperonin groel at 2.8 angstrom resolution
PDB Compounds: (F:) groEL (hsp60 class)

SCOPe Domain Sequences for d1oelf3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oelf3 d.56.1.1 (F:137-190,F:367-409) GroEL, I domain {Escherichia coli [TaxId: 562]}
pcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgtglqdeldvvXervak
laggvavikvgaatevemkekkarvedalhatraavee

SCOPe Domain Coordinates for d1oelf3:

Click to download the PDB-style file with coordinates for d1oelf3.
(The format of our PDB-style files is described here.)

Timeline for d1oelf3: