Lineage for d6tj8b3 (6tj8 B:528-663)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2488514Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 2488515Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) (S)
  5. 2488687Family c.48.1.0: automated matches [227237] (1 protein)
    not a true family
  6. 2488688Protein automated matches [226991] (9 species)
    not a true protein
  7. 2488709Species Escherichia coli [TaxId:83333] [324642] (4 PDB entries)
  8. 2488711Domain d6tj8b3: 6tj8 B:528-663 [389048]
    Other proteins in same PDB: d6tj8a1, d6tj8a2, d6tj8a4, d6tj8b1, d6tj8b2, d6tj8b4
    automated match to d2r8oa3
    complexed with ca, edo, ndq

Details for d6tj8b3

PDB Entry: 6tj8 (more details), 0.92 Å

PDB Description: escherichia coli transketolase in complex with cofactor analog 2'- methoxythiamine diphosphate
PDB Compounds: (B:) Transketolase 1

SCOPe Domain Sequences for d6tj8b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tj8b3 c.48.1.0 (B:528-663) automated matches {Escherichia coli [TaxId: 83333]}
rteeqlaniarggyvlkdcagqpelifiatgsevelavaayekltaegvkarvvsmpstd
afdkqdaayresvlpkavtarvaveagiadywykyvglngaivgmttfgesapaellfee
fgftvdnvvakakell

SCOPe Domain Coordinates for d6tj8b3:

Click to download the PDB-style file with coordinates for d6tj8b3.
(The format of our PDB-style files is described here.)

Timeline for d6tj8b3: