Lineage for d1oele3 (1oel E:137-190,E:367-409)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 79950Fold d.56: GroEL-like chaperone, intermediate domain [54848] (1 superfamily)
  4. 79951Superfamily d.56.1: GroEL-like chaperone, intermediate domain [54849] (2 families) (S)
  5. 79952Family d.56.1.1: GroEL [54850] (1 protein)
  6. 79953Protein GroEL [54851] (1 species)
  7. 79954Species Escherichia coli [TaxId:562] [54852] (4 PDB entries)
  8. 79959Domain d1oele3: 1oel E:137-190,E:367-409 [38904]
    Other proteins in same PDB: d1oela1, d1oela2, d1oelb1, d1oelb2, d1oelc3, d1oelc5, d1oeld1, d1oeld2, d1oele1, d1oele2, d1oelf1, d1oelf2, d1oelg1, d1oelg2

Details for d1oele3

PDB Entry: 1oel (more details), 2.8 Å

PDB Description: conformational variability in the refined structure of the chaperonin groel at 2.8 angstrom resolution

SCOP Domain Sequences for d1oele3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oele3 d.56.1.1 (E:137-190,E:367-409) GroEL {Escherichia coli}
pcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgtglqdeldvvXervak
laggvavikvgaatevemkekkarvedalhatraavee

SCOP Domain Coordinates for d1oele3:

Click to download the PDB-style file with coordinates for d1oele3.
(The format of our PDB-style files is described here.)

Timeline for d1oele3: