Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Camelus bactrianus [TaxId:9837] [388978] (1 PDB entry) |
Domain d6rqmb_: 6rqm B: [388979] Other proteins in same PDB: d6rqma_ automated match to d3cx5j_ |
PDB Entry: 6rqm (more details), 3 Å
SCOPe Domain Sequences for d6rqmb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6rqmb_ b.1.1.0 (B:) automated matches {Camelus bactrianus [TaxId: 9837]} qvqlvesggglvqpggslrlscaasgyiysaycmgwfrqapgkglegvaaiyigggstyy adsvkgrftisrdnskntlylqmnslraedtavyycaadviptetclggswsgpfgywgq gtlvtvss
Timeline for d6rqmb_: