Lineage for d6rqmb_ (6rqm B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754065Species Camelus bactrianus [TaxId:9837] [388978] (1 PDB entry)
  8. 2754066Domain d6rqmb_: 6rqm B: [388979]
    Other proteins in same PDB: d6rqma_
    automated match to d3cx5j_

Details for d6rqmb_

PDB Entry: 6rqm (more details), 3 Å

PDB Description: a blocking anti-ctla-4 nanobody (kn044) complexed with ctla-4
PDB Compounds: (B:) A blocking anti-CTLA-4 nanobody (KN044)

SCOPe Domain Sequences for d6rqmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6rqmb_ b.1.1.0 (B:) automated matches {Camelus bactrianus [TaxId: 9837]}
qvqlvesggglvqpggslrlscaasgyiysaycmgwfrqapgkglegvaaiyigggstyy
adsvkgrftisrdnskntlylqmnslraedtavyycaadviptetclggswsgpfgywgq
gtlvtvss

SCOPe Domain Coordinates for d6rqmb_:

Click to download the PDB-style file with coordinates for d6rqmb_.
(The format of our PDB-style files is described here.)

Timeline for d6rqmb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6rqma_