Lineage for d6plha1 (6plh A:1-112)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744217Domain d6plha1: 6plh A:1-112 [388937]
    Other proteins in same PDB: d6plha2
    automated match to d1t66c1
    complexed with man, po4

Details for d6plha1

PDB Entry: 6plh (more details), 1.6 Å

PDB Description: fab fragment complexed with c-mannosylated tryptophan peptide
PDB Compounds: (A:) Fab 5G12 light chain

SCOPe Domain Sequences for d6plha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6plha1 b.1.1.1 (A:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvvmthtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgadftlkisrveaedlgvyfcsqsthvprtfgggtkleik

SCOPe Domain Coordinates for d6plha1:

Click to download the PDB-style file with coordinates for d6plha1.
(The format of our PDB-style files is described here.)

Timeline for d6plha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6plha2
View in 3D
Domains from other chains:
(mouse over for more information)
d6plhb_