Lineage for d6kuzb5 (6kuz B:731-1023)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2375752Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2375891Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2376363Family b.30.5.0: automated matches [227145] (1 protein)
    not a true family
  6. 2376364Protein automated matches [226849] (8 species)
    not a true protein
  7. 2376447Species Escherichia coli [TaxId:83333] [272144] (5 PDB entries)
  8. 3088848Domain d6kuzb5: 6kuz B:731-1023 [388910]
    Other proteins in same PDB: d6kuza1, d6kuza2, d6kuza3, d6kuza4, d6kuzb1, d6kuzb2, d6kuzb3, d6kuzb4, d6kuzc1, d6kuzc2, d6kuzc3, d6kuzc4, d6kuzd1, d6kuzd2, d6kuzd3, d6kuzd4
    automated match to d1jz8a4
    complexed with dms, dvl, gol, mg, na

Details for d6kuzb5

PDB Entry: 6kuz (more details), 2.83 Å

PDB Description: e.coli beta-galactosidase (e537q) in complex with fluorescent probe ksl01
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d6kuzb5:

Sequence; same for both SEQRES and ATOM records: (download)

>d6kuzb5 b.30.5.0 (B:731-1023) automated matches {Escherichia coli [TaxId: 83333]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOPe Domain Coordinates for d6kuzb5:

Click to download the PDB-style file with coordinates for d6kuzb5.
(The format of our PDB-style files is described here.)

Timeline for d6kuzb5:

  • d6kuzb5 is new in SCOPe 2.07-stable