Lineage for d6kuzb3 (6kuz B:334-625)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832343Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2832344Protein automated matches [190075] (132 species)
    not a true protein
  7. 2832651Species Escherichia coli [TaxId:83333] [272137] (17 PDB entries)
  8. 2832686Domain d6kuzb3: 6kuz B:334-625 [388908]
    Other proteins in same PDB: d6kuza1, d6kuza2, d6kuza4, d6kuza5, d6kuzb1, d6kuzb2, d6kuzb4, d6kuzb5, d6kuzc1, d6kuzc2, d6kuzc4, d6kuzc5, d6kuzd1, d6kuzd2, d6kuzd4, d6kuzd5
    automated match to d1jz7a5
    complexed with dms, dvl, gol, mg, na

Details for d6kuzb3

PDB Entry: 6kuz (more details), 2.83 Å

PDB Description: e.coli beta-galactosidase (e537q) in complex with fluorescent probe ksl01
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d6kuzb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6kuzb3 c.1.8.0 (B:334-625) automated matches {Escherichia coli [TaxId: 83333]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilcqyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d6kuzb3:

Click to download the PDB-style file with coordinates for d6kuzb3.
(The format of our PDB-style files is described here.)

Timeline for d6kuzb3: