SCOPe 2.08: Domain d2mnra2: 2mnr A:3-132

Lineage for d2mnra2 (2mnr A:3-132)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein Mandelate racemase [54838] (3 species)

7. Species Pseudomonas putida [TaxId:303] [54839] (6 PDB entries)

8. Domain d2mnra2: 2mnr A:3-132 [38889]
   Other proteins in same PDB: d2mnra1
   complexed with mn, so4

Details for d2mnra2

PDB Entry: 2mnr, 1.9 Å

PDB Description: mechanism of the reaction catalyzed by mandelate racemase. 2. crystal structure of mandelate racemase at 2.5 angstroms resolution: identification of the active site and possible catalytic residues

PDB Compounds: (A:) mandelate racemase

SCOPe Domain Sequences for d2mnra2:

Sequence; same for both SEQRES and ATOM records:

>d2mnra2 d.54.1.1 (A:3-132) Mandelate racemase {Pseudomonas putida [TaxId: 303]}
evlitglrtravnvplaypvhtavgtvgtaplvlidlatsagvvghsylfaytpvalksl
kqllddmaamivneplapvsleamlakrfclagytglirmaaagidmaawdalgkvhetp
lvkllganar

Timeline for d2mnra2:

• d2mnra2 first appeared (with stable ids) in SCOP 1.55, called d2mnr_2
  
• d2mnra2 appears in SCOPe 2.07